xceptional.net - robtex.com

xceptional.net

net

Previously MX for

Same first word

Similar names

DNS History

22 records (4 active, 18 former)

2008201020122014201620182020202220242026NSns1.afternic.comns2.afternic.comns-us.1and1-dns.comns-us.1and1-dns.dens-us.1and1-dns.orgns-us.1and1-dns.usns.buydomains.comns1.ipage.comns1.webhostingpad.comns2.ipage.comns2.webhostingpad.comthis-domain-for-sale.comMXdev.nullmx.xceptional.netxceptional.netA13.248.169.4876.223.54.146208.254.26.13250.21.179.7566.96.147.14469.39.232.6674.208.215.95
β—‹NSns-us.1and1-dns.com2015-11-05 β†’ 2016-12-25 Β· 5 obs
β—‹ 2015-06-16 04:13:10
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
β—‹ 2017-10-14 07:48:30
β—‹ 2026-04-14 08:19:18
β—‹NSns-us.1and1-dns.de2015-11-05 β†’ 2016-12-25 Β· 5 obs
β—‹ 2015-06-16 04:13:10
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
β—‹ 2017-10-14 07:48:30
β—‹ 2026-04-14 08:19:18
β—‹NSns-us.1and1-dns.org2015-11-05 β†’ 2016-12-25 Β· 5 obs
β—‹ 2015-06-16 04:13:10
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
β—‹ 2017-10-14 07:48:30
β—‹ 2026-04-14 08:19:18
β—‹NSns-us.1and1-dns.us2015-11-05 β†’ 2016-12-25 Β· 5 obs
β—‹ 2015-06-16 04:13:10
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
β—‹ 2017-10-14 07:48:30
β—‹ 2026-04-14 08:19:18
β—‹NSns.buydomains.com2007-10-02 β†’ 2007-10-02 Β· 3 obs
● 2007-10-02 07:35:04
β—‹ 2015-06-16 04:13:10
β—‹ 2026-04-14 08:19:18
●NSns1.afternic.com2026-03-27 β†’ 2026-04-14 Β· 3 obs
β—‹ 2017-10-14 07:48:30
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
β—‹NSns1.ipage.com2017-10-14 β†’ 2017-10-14 Β· 4 obs
β—‹ 2016-12-25 03:08:26
● 2017-10-14 07:48:30
β—‹ 2026-03-27 08:30:52
β—‹ 2026-04-14 08:19:18
β—‹NSns1.webhostingpad.com2015-06-16 β†’ 2015-06-16 Β· 4 obs
β—‹ 2007-10-02 07:35:04
● 2015-06-16 04:13:10
β—‹ 2015-11-05 10:25:42
β—‹ 2026-04-14 08:19:18
●NSns2.afternic.com2026-03-27 β†’ 2026-04-14 Β· 3 obs
β—‹ 2017-10-14 07:48:30
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
β—‹NSns2.ipage.com2017-10-14 β†’ 2017-10-14 Β· 4 obs
β—‹ 2016-12-25 03:08:26
● 2017-10-14 07:48:30
β—‹ 2026-03-27 08:30:52
β—‹ 2026-04-14 08:19:18
β—‹NSns2.webhostingpad.com2015-06-16 β†’ 2015-06-16 Β· 4 obs
β—‹ 2007-10-02 07:35:04
● 2015-06-16 04:13:10
β—‹ 2015-11-05 10:25:42
β—‹ 2026-04-14 08:19:18
β—‹NSthis-domain-for-sale.com2007-10-02 β†’ 2007-10-02 Β· 3 obs
● 2007-10-02 07:35:04
β—‹ 2015-06-16 04:13:10
β—‹ 2026-04-14 08:19:18
β—‹MXdev.null2007-10-02 β†’ 2007-10-02 Β· 3 obs
● 2007-10-02 07:35:04
β—‹ 2015-06-16 04:13:10
β—‹ 2026-04-14 08:19:18
β—‹MXmx.xceptional.net2017-10-14 β†’ 2017-10-14 Β· 4 obs
β—‹ 2015-11-05 10:25:42
● 2017-10-14 07:48:30
β—‹ 2026-03-27 08:30:52
β—‹ 2026-04-14 08:19:18
β—‹MXxceptional.net2015-06-16 β†’ 2015-06-16 Β· 4 obs
β—‹ 2007-10-02 07:35:04
● 2015-06-16 04:13:10
β—‹ 2015-11-05 10:25:42
β—‹ 2026-04-14 08:19:18
●A13.248.169.482026-03-27 β†’ 2026-04-14 Β· 3 obs
β—‹ 2017-10-14 07:48:30
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
β—‹A208.254.26.1322007-10-02 β†’ 2007-10-02 Β· 3 obs
● 2007-10-02 07:35:04
β—‹ 2015-06-16 04:13:10
β—‹ 2026-04-14 08:19:18
β—‹A50.21.179.752015-11-05 β†’ 2016-05-11 Β· 5 obs
β—‹ 2015-06-16 04:13:10
● 2015-11-05 10:25:42
● 2016-05-11 09:11:12
β—‹ 2016-12-25 03:08:26
β—‹ 2026-04-14 08:19:18
β—‹A66.96.147.1442017-10-14 β†’ 2017-10-14 Β· 4 obs
β—‹ 2016-12-25 03:08:26
● 2017-10-14 07:48:30
β—‹ 2026-03-27 08:30:52
β—‹ 2026-04-14 08:19:18
β—‹A69.39.232.662015-06-16 β†’ 2015-06-16 Β· 4 obs
β—‹ 2007-10-02 07:35:04
● 2015-06-16 04:13:10
β—‹ 2015-11-05 10:25:42
β—‹ 2026-04-14 08:19:18
β—‹A74.208.215.952016-12-25 β†’ 2016-12-25 Β· 4 obs
β—‹ 2016-05-11 09:11:12
● 2016-12-25 03:08:26
β—‹ 2017-10-14 07:48:30
β—‹ 2026-04-14 08:19:18
●A76.223.54.1462026-03-27 β†’ 2026-04-14 Β· 3 obs
β—‹ 2017-10-14 07:48:30
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18

πŸ” DNS Trace

πŸ“‹ Delegation Chain

ZoneNameserversGlue
netd.gtld-servers.net, a.gtld-servers.net, f.gtld-servers.net, l.gtld-servers.net...-
xceptional.netns1.afternic.com, ns2.afternic.com-

βœ… Authoritative Response

Server:97.74.98.69

NS records: ns1.afternic.com, ns2.afternic.com

πŸ”’ DNSSEC Status

⚠️ Insecure (no DNSSEC)

No DS record for xceptional.net (unsigned zone)

⏱️ Timing

Total: 106ms | Queries: -

πŸ“„ Records

TypeCountSample Data
A276.223.54.146, 13.248.169.48
NS2ns1.afternic.com, ns2.afternic.com
MX1. (pri: 0)
TXT1v=spf1 -all
SOA1ns1.afternic.com dns.jomax.net

Analysis

IP Addresses

xceptional.net points to two IP numbers: 13.248.169.48 and 76.223.54.146.

Other host names, for instance pilotdomain.com, wellbehavedwomen.com, platformx.shop, 3dfilm.com and winnhealthcare.com share IP numbers with xceptional.net.

Name Servers

Delegation for xceptional.net rests with two name servers, ns1.afternic.com and ns2.afternic.com.

xceptional.net shares the same name server setup as other domains, including bookessay.com, servershome.com, marshalelectronics.com, gdwtechnology.com and howdoisavemymarriagewhenshesleftsite2013.publicsets.com.

xceptional.net at least partially shares name servers with other domains, for instance gingeroo.com, podcastmavens.com, anecdotecreative.com, adinbeachhotel.com and penguinrobot.com.

These name servers are commonly used with the name servers verification-d3jclucsp89ganyqbydeny.ns101.verify.hn.

Host names with two IP numbers: ns1.afternic.com points to 2603:5:2126::45 and 97.74.98.69; ns2.afternic.com points to 2603:5:2226::45 and 173.201.66.69.