xceptional.net - robtex.com
xceptional.net
| DNSSEC | ⚠️ Not signed | ||||||
| A | 13.248.169.48🇺🇸 Amazon13.248.160.0/20 | ||||||
| PTR | a904c694c05102f30.awsglobalaccelerator.com | ||||||
| A | 76.223.54.146🇺🇸 Amazon76.223.48.0/20 | ||||||
| NS | ns2.afternic.com ⭐ | ||||||
| A | 2603:5:2226::45🇺🇸 GODADDY-DNS2603:5:2220::/44 | ||||||
| PTR | ns2.afternic.com | ||||||
| A | 173.201.66.69🇺🇸 GODADDY-DNS173.201.66.0/23 | ||||||
| PTR | ns2.afternic.com | ||||||
| NS | ns1.afternic.com | ||||||
| A | 2603:5:2126::45🇺🇸 GODADDY-DNS2603:5:2120::/44 | ||||||
| PTR | ns1.afternic.com | ||||||
| A | 97.74.98.69🇺🇸 GODADDY-DNS97.74.98.0/23 | ||||||
| PTR | ns1.afternic.com | ||||||
| TXT | v=spf1 -all | ||||||
| SOA | ns2.afternic.comdns@jomax.net serial=1 | ||||||
net
| DNSSEC | 🔒 Signed (DS record present) | ||||||
| NS | a.gtld-servers.net ⭐ | ||||||
| NS | b.gtld-servers.net | ||||||
| NS | c.gtld-servers.net | ||||||
| NS | d.gtld-servers.net | ||||||
| NS | e.gtld-servers.net | ||||||
| NS | f.gtld-servers.net | ||||||
| NS | g.gtld-servers.net | ||||||
| NS | h.gtld-servers.net | ||||||
| NS | i.gtld-servers.net | ||||||
| NS | j.gtld-servers.net | ||||||
| NS | k.gtld-servers.net | ||||||
| NS | l.gtld-servers.net | ||||||
| NS | m.gtld-servers.net | ||||||
| SOA | a.gtld-servers.netnstld@verisign-grs.com serial=1776152992 | ||||||
Previously MX for
xceptional.net |
Same first word
xceptional.net |
xceptional.nl |
xceptional.co |
xceptional.biz |
Similar names
DNS History
22 records (4 active, 18 former)
○NSns-us.1and1-dns.com2015-11-05 → 2016-12-25 · 5 obs
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
○ 2017-10-14 07:48:30
○ 2026-04-14 08:19:18
○NSns-us.1and1-dns.de2015-11-05 → 2016-12-25 · 5 obs
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
○ 2017-10-14 07:48:30
○ 2026-04-14 08:19:18
○NSns-us.1and1-dns.org2015-11-05 → 2016-12-25 · 5 obs
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
○ 2017-10-14 07:48:30
○ 2026-04-14 08:19:18
○NSns-us.1and1-dns.us2015-11-05 → 2016-12-25 · 5 obs
● 2015-11-05 10:25:42
● 2016-12-25 03:08:26
○ 2017-10-14 07:48:30
○ 2026-04-14 08:19:18
○NSns.buydomains.com2007-10-02 → 2007-10-02 · 3 obs
○ 2015-06-16 04:13:10
○ 2026-04-14 08:19:18
●NSns1.afternic.com2026-03-27 → 2026-04-14 · 3 obs
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
○NSns1.ipage.com2017-10-14 → 2017-10-14 · 4 obs
● 2017-10-14 07:48:30
○ 2026-03-27 08:30:52
○ 2026-04-14 08:19:18
○NSns1.webhostingpad.com2015-06-16 → 2015-06-16 · 4 obs
● 2015-06-16 04:13:10
○ 2015-11-05 10:25:42
○ 2026-04-14 08:19:18
●NSns2.afternic.com2026-03-27 → 2026-04-14 · 3 obs
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
○NSns2.ipage.com2017-10-14 → 2017-10-14 · 4 obs
● 2017-10-14 07:48:30
○ 2026-03-27 08:30:52
○ 2026-04-14 08:19:18
○NSns2.webhostingpad.com2015-06-16 → 2015-06-16 · 4 obs
● 2015-06-16 04:13:10
○ 2015-11-05 10:25:42
○ 2026-04-14 08:19:18
○NSthis-domain-for-sale.com2007-10-02 → 2007-10-02 · 3 obs
○ 2015-06-16 04:13:10
○ 2026-04-14 08:19:18
○MXdev.null2007-10-02 → 2007-10-02 · 3 obs
○ 2015-06-16 04:13:10
○ 2026-04-14 08:19:18
○MXmx.xceptional.net2017-10-14 → 2017-10-14 · 4 obs
● 2017-10-14 07:48:30
○ 2026-03-27 08:30:52
○ 2026-04-14 08:19:18
○MXxceptional.net2015-06-16 → 2015-06-16 · 4 obs
● 2015-06-16 04:13:10
○ 2015-11-05 10:25:42
○ 2026-04-14 08:19:18
●A13.248.169.482026-03-27 → 2026-04-14 · 3 obs
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
○A208.254.26.1322007-10-02 → 2007-10-02 · 3 obs
○ 2015-06-16 04:13:10
○ 2026-04-14 08:19:18
○A50.21.179.752015-11-05 → 2016-05-11 · 5 obs
● 2015-11-05 10:25:42
● 2016-05-11 09:11:12
○ 2016-12-25 03:08:26
○ 2026-04-14 08:19:18
○A66.96.147.1442017-10-14 → 2017-10-14 · 4 obs
● 2017-10-14 07:48:30
○ 2026-03-27 08:30:52
○ 2026-04-14 08:19:18
○A69.39.232.662015-06-16 → 2015-06-16 · 4 obs
● 2015-06-16 04:13:10
○ 2015-11-05 10:25:42
○ 2026-04-14 08:19:18
○A74.208.215.952016-12-25 → 2016-12-25 · 4 obs
● 2016-12-25 03:08:26
○ 2017-10-14 07:48:30
○ 2026-04-14 08:19:18
●A76.223.54.1462026-03-27 → 2026-04-14 · 3 obs
● 2026-03-27 08:30:52
● 2026-04-14 08:19:18
🔍 DNS Trace
📋 Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| net | d.gtld-servers.net, a.gtld-servers.net, f.gtld-servers.net, l.gtld-servers.net... | - |
| xceptional.net | ns1.afternic.com, ns2.afternic.com | - |
✅ Authoritative Response
Server:97.74.98.69
NS records: ns1.afternic.com, ns2.afternic.com
🔒 DNSSEC Status
⚠️ Insecure (no DNSSEC)
No DS record for xceptional.net (unsigned zone)
⏱️ Timing
Total: 106ms | Queries: -
📄 Records
| Type | Count | Sample Data |
|---|---|---|
| A | 2 | 76.223.54.146, 13.248.169.48 |
| NS | 2 | ns1.afternic.com, ns2.afternic.com |
| MX | 1 | . (pri: 0) |
| TXT | 1 | v=spf1 -all |
| SOA | 1 | ns1.afternic.com dns.jomax.net |
Analysis
IP Addresses
xceptional.net points to two IP numbers: 13.248.169.48 and 76.223.54.146.
Other host names, for instance pilotdomain.com, wellbehavedwomen.com, platformx.shop, 3dfilm.com and winnhealthcare.com share IP numbers with xceptional.net.
Name Servers
Delegation for xceptional.net rests with two name servers, ns1.afternic.com and ns2.afternic.com.
xceptional.net shares the same name server setup as other domains, including bookessay.com, servershome.com, marshalelectronics.com, gdwtechnology.com and howdoisavemymarriagewhenshesleftsite2013.publicsets.com.
xceptional.net at least partially shares name servers with other domains, for instance gingeroo.com, podcastmavens.com, anecdotecreative.com, adinbeachhotel.com and penguinrobot.com.
These name servers are commonly used with the name servers verification-d3jclucsp89ganyqbydeny.ns101.verify.hn.
Host names with two IP numbers: ns1.afternic.com points to 2603:5:2126::45 and 97.74.98.69; ns2.afternic.com points to 2603:5:2226::45 and 173.201.66.69.