tecnoacces.com - robtex.com
tecnoacces.com
| DNSSEC | ⚠️ Not signed | ||||||
| A | 15.197.240.20🇺🇸 Amazon15.197.240.0/20 | ||||||
| PTR | acf3b736b777428f5.awsglobalaccelerator.com | ||||||
| NS | ns1.verification-hold.suspended-domain.com ⭐ | ||||||
| A | 127.0.0.1 | ||||||
| NS | dns10.parkpage.foundationapi.com ⚠️ Not in zone NS records | ||||||
| A | 162.251.82.2🇺🇸 Cloudflare162.251.82.0/24 PDR | ||||||
| NS | dns11.parkpage.foundationapi.com ⚠️ Not in zone NS records | ||||||
| A | 162.251.82.254🇺🇸 Cloudflare162.251.82.0/24 PDR | ||||||
| SOA | ns1.verification-hold.suspended-domain.comadmin@suspended-domain.com 2012-02-20 #12 | ||||||
com
| DNSSEC | 🔒 Signed (DS record present) | ||||||
| NS | a.gtld-servers.net ⭐ | ||||||
| NS | b.gtld-servers.net | ||||||
| NS | c.gtld-servers.net | ||||||
| NS | d.gtld-servers.net | ||||||
| NS | e.gtld-servers.net | ||||||
| NS | f.gtld-servers.net | ||||||
| NS | g.gtld-servers.net | ||||||
| NS | h.gtld-servers.net | ||||||
| NS | i.gtld-servers.net | ||||||
| NS | j.gtld-servers.net | ||||||
| NS | k.gtld-servers.net | ||||||
| NS | l.gtld-servers.net | ||||||
| NS | m.gtld-servers.net | ||||||
| SOA | a.gtld-servers.netnstld@verisign-grs.com serial=1774720842 | ||||||
Same first word
tecnoacces.com |
DNS History
9 records (4 active, 5 former)
●NSdns10.parkpage.foundationapi.com2026-03-28 → 2026-03-28 · 3 obs
● 2026-03-28 11:05:32
● 2026-03-28 18:25:00
●NSdns11.parkpage.foundationapi.com2026-03-28 → 2026-03-28 · 3 obs
● 2026-03-28 11:05:32
● 2026-03-28 18:25:00
●NSns1.verification-hold.suspended-domain.com2026-03-28 → 2026-03-28 · 3 obs
● 2026-03-28 11:05:32
● 2026-03-28 18:25:00
○NSns26.hostgator.co2026-02-25 → 2026-03-24 · 4 obs
● 2026-03-24 06:59:34
○ 2026-03-28 11:05:32
○ 2026-03-28 18:25:00
○NSns27.hostgator.co2026-02-25 → 2026-03-24 · 4 obs
● 2026-03-24 06:59:34
○ 2026-03-28 11:05:32
○ 2026-03-28 18:25:00
○MXmx1.titan.email2026-02-25 → 2026-03-24 · 4 obs
● 2026-03-24 06:59:34
○ 2026-03-28 11:05:32
○ 2026-03-28 18:25:00
○MXmx2.titan.email2026-02-25 → 2026-03-24 · 4 obs
● 2026-03-24 06:59:34
○ 2026-03-28 11:05:32
○ 2026-03-28 18:25:00
●A15.197.240.202026-03-28 → 2026-03-28 · 3 obs
● 2026-03-28 11:05:32
● 2026-03-28 18:25:00
○A162.241.61.2482026-02-25 → 2026-03-24 · 4 obs
● 2026-03-24 06:59:34
○ 2026-03-28 11:05:32
○ 2026-03-28 18:25:00
🔍 DNS Trace
📋 Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| com | a.gtld-servers.net, b.gtld-servers.net, c.gtld-servers.net, d.gtld-servers.net... | - |
| tecnoacces.com | dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com | 2 records |
✅ Authoritative Response
Server:162.251.82.2
NS records: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com
🔒 DNSSEC Status
⚠️ Insecure (no DNSSEC)
No DS record for tecnoacces.com (unsigned zone)
⏱️ Timing
Total: 217ms | Queries: -
📄 Records
| Type | Count | Sample Data |
|---|---|---|
| A | 1 | 15.197.240.20 |
| SOA | 1 | ns1.verification-hold.suspended-domain.c |
📌 Glue Records Collected
Total: 2
Out-of-bailiwick: 2 (dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com)
Analysis
IP Addresses
tecnoacces.com resolves to one IP number: 15.197.240.20.
other host names including realconstructora.com, www.lifeseasoned.com, hu.www.mediarab.com, biznessclinic.life and extension-browser-nkbihsdfnklwefkwemkwfkmkmslqldqrgr.info.vancltyappllance.com share IP numbers with tecnoacces.com.
Name Servers
tecnoacces.com is delegated to three name servers dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com and ns1.verification-hold.suspended-domain.com.
tecnoacces.com at least partially shares name servers with other domains, for instance treyandjackie.com, arabun.com, plusyemektarifleri.com, jasapembuatanskripsi.net and ltjqm.com.
These name servers are commonly used with dns9.parkpage.foundationapi.com, ns2.verification-hold.suspended-domain.com, dns7.parkpage.foundationapi.com, dns8.parkpage.foundationapi.com and dns12.parkpage.foundationapi.com.
Host names with one IP number: dns10.parkpage.foundationapi.com points to 162.251.82.2; dns11.parkpage.foundationapi.com points to 162.251.82.254; ns1.verification-hold.suspended-domain.com points to 127.0.0.1.