mideacrac.com - robtex.com

mideacrac.com

DNSSEC⚠️ Not signed
A15.197.240.20πŸ‡ΊπŸ‡Έ Amazon15.197.240.0/20
PTRacf3b736b777428f5.awsglobalaccelerator.com
NSns1.verification-hold.suspended-domain.com ⭐
A127.0.0.1
NSdns10.parkpage.foundationapi.com ⚠️ Not in zone NS records
A162.251.82.2πŸ‡ΊπŸ‡Έ Cloudflare162.251.82.0/24 PDR
NSdns11.parkpage.foundationapi.com ⚠️ Not in zone NS records
A162.251.82.254πŸ‡ΊπŸ‡Έ Cloudflare162.251.82.0/24 PDR
SOAns1.verification-hold.suspended-domain.comadmin@suspended-domain.com 2012-02-20 #12

com

Same first word

Similar names

DNS History

17 records (4 active, 13 former)

20162017201820192020202120222023202420252026NSdns10.parkpage.foundationapi.comdns11.parkpage.foundationapi.comns1.verification-hold.suspended-domain.comdm1.longmingdns.comdm2.longmingdns.comns1.ezdnscenter.comns2.ezdnscenter.comns3.ezdnscenter.comns4.dnsdun.comns4.dnsdun.netns4.ezdnscenter.comns5.ezdnscenter.comns6.ezdnscenter.comA15.197.240.20104.195.4.3123.1.183.11723.80.247.148
β—‹NSdm1.longmingdns.com2026-03-10 β†’ 2026-03-25 Β· 2 obs
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04
β—‹NSdm2.longmingdns.com2026-03-10 β†’ 2026-03-25 Β· 2 obs
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04
●NSdns10.parkpage.foundationapi.com2026-03-10 β†’ 2026-03-25 Β· 3 obs
β—‹ 2018-06-16 00:33:22
● 2026-03-10 09:02:30
● 2026-03-25 06:02:04
●NSdns11.parkpage.foundationapi.com2026-03-10 β†’ 2026-03-25 Β· 3 obs
β—‹ 2018-06-16 00:33:22
● 2026-03-10 09:02:30
● 2026-03-25 06:02:04
β—‹NSns1.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
●NSns1.verification-hold.suspended-domain.com2026-03-10 β†’ 2026-03-25 Β· 3 obs
β—‹ 2018-06-16 00:33:22
● 2026-03-10 09:02:30
● 2026-03-25 06:02:04
β—‹NSns2.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
β—‹NSns3.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
β—‹NSns4.dnsdun.com2018-06-16 β†’ 2018-06-16 Β· 4 obs
β—‹ 2016-06-26 05:38:56
● 2018-06-16 00:33:22
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04
β—‹NSns4.dnsdun.net2018-06-16 β†’ 2018-06-16 Β· 4 obs
β—‹ 2016-06-26 05:38:56
● 2018-06-16 00:33:22
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04
β—‹NSns4.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
β—‹NSns5.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
β—‹NSns6.ezdnscenter.com2015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
β—‹A104.195.4.32026-03-10 β†’ 2026-03-25 Β· 2 obs
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04
β—‹A123.1.183.1172015-08-13 β†’ 2016-06-26 Β· 4 obs
● 2015-08-13 14:33:04
● 2016-06-26 05:38:56
β—‹ 2018-06-16 00:33:22
β—‹ 2026-03-25 06:02:04
●A15.197.240.202026-03-10 β†’ 2026-03-25 Β· 3 obs
β—‹ 2018-06-16 00:33:22
● 2026-03-10 09:02:30
● 2026-03-25 06:02:04
β—‹A23.80.247.1482018-06-16 β†’ 2018-06-16 Β· 4 obs
β—‹ 2016-06-26 05:38:56
● 2018-06-16 00:33:22
β—‹ 2026-03-10 09:02:30
β—‹ 2026-03-25 06:02:04

πŸ” DNS Trace

πŸ“‹ Delegation Chain

ZoneNameserversGlue
comd.gtld-servers.net, m.gtld-servers.net, f.gtld-servers.net, g.gtld-servers.net...-
mideacrac.comdns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com2 records

βœ… Authoritative Response

Server:162.251.82.2

NS records: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com

πŸ”’ DNSSEC Status

⚠️ Insecure (no DNSSEC)

No DS record for mideacrac.com (unsigned zone)

⏱️ Timing

Total: 255ms | Queries: -

πŸ“„ Records

TypeCountSample Data
A115.197.240.20
SOA1ns1.verification-hold.suspended-domain.c

πŸ“Œ Glue Records Collected

Total: 2

Out-of-bailiwick: 2 (dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com)

Analysis

IP Addresses

mideacrac.com points to IP number: 15.197.240.20.

Other host names such as www.lifeseasoned.com, hu.www.mediarab.com, biznessclinic.life, extension-browser-nkbihsdfnklwefkwemkwfkmkmslqldqrgr.info.vancltyappllance.com and great(0x6675636b).info share IPs with mideacrac.com.

Name Servers

mideacrac.com is delegated to three name servers: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com and ns1.verification-hold.suspended-domain.com.

mideacrac.com at least partially shares name servers with other domains, for instance mailserver47-coinbase.com, arindam.tech, coinbase-100550.com, fireplacemantel.info and alpamediamx.com.

these name servers are commonly used together with the name servers dns12.parkpage.foundationapi.com, ns2.verification-hold.suspended-domain.com, dns9.parkpage.foundationapi.com, dns7.parkpage.foundationapi.com and dns8.parkpage.foundationapi.com.

Host names with a single IP:

dns10.parkpage.foundationapi.com points to: 162.251.82.2.

dns11.parkpage.foundationapi.com points to: 162.251.82.254.

ns1.verification-hold.suspended-domain.com points to: 127.0.0.1.