mideacrac.com - robtex.com
mideacrac.com
| DNSSEC | β οΈ Not signed | ||||||
| A | 15.197.240.20πΊπΈ Amazon15.197.240.0/20 | ||||||
| PTR | acf3b736b777428f5.awsglobalaccelerator.com | ||||||
| NS | ns1.verification-hold.suspended-domain.com β | ||||||
| A | 127.0.0.1 | ||||||
| NS | dns10.parkpage.foundationapi.com β οΈ Not in zone NS records | ||||||
| A | 162.251.82.2πΊπΈ Cloudflare162.251.82.0/24 PDR | ||||||
| NS | dns11.parkpage.foundationapi.com β οΈ Not in zone NS records | ||||||
| A | 162.251.82.254πΊπΈ Cloudflare162.251.82.0/24 PDR | ||||||
| SOA | ns1.verification-hold.suspended-domain.comadmin@suspended-domain.com 2012-02-20 #12 | ||||||
com
| DNSSEC | π Signed (DS record present) | ||||||
| NS | a.gtld-servers.net β | ||||||
| NS | b.gtld-servers.net | ||||||
| NS | c.gtld-servers.net | ||||||
| NS | d.gtld-servers.net | ||||||
| NS | e.gtld-servers.net | ||||||
| NS | f.gtld-servers.net | ||||||
| NS | g.gtld-servers.net | ||||||
| NS | h.gtld-servers.net | ||||||
| NS | i.gtld-servers.net | ||||||
| NS | j.gtld-servers.net | ||||||
| NS | k.gtld-servers.net | ||||||
| NS | l.gtld-servers.net | ||||||
| NS | m.gtld-servers.net | ||||||
| SOA | a.gtld-servers.netnstld@verisign-grs.com serial=1774418422 | ||||||
Same first word
mideacrac.com |
Similar names
cicaderma.com |
madeiracc.org |
adceramic.com |
cicaderma.net |
americadc.com |
arcademic.com |
cicaderma.cz |
arcmedica.com |
academicr.com |
caramedic.com |
cdamerica.com |
carmedica.de |
cicaderma.org |
carmedica.com.br |
carcmedia.com |
DNS History
17 records (4 active, 13 former)
βNSdm1.longmingdns.com2026-03-10 β 2026-03-25 Β· 2 obs
β 2026-03-25 06:02:04
βNSdm2.longmingdns.com2026-03-10 β 2026-03-25 Β· 2 obs
β 2026-03-25 06:02:04
βNSdns10.parkpage.foundationapi.com2026-03-10 β 2026-03-25 Β· 3 obs
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βNSdns11.parkpage.foundationapi.com2026-03-10 β 2026-03-25 Β· 3 obs
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βNSns1.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βNSns1.verification-hold.suspended-domain.com2026-03-10 β 2026-03-25 Β· 3 obs
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βNSns2.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βNSns3.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βNSns4.dnsdun.com2018-06-16 β 2018-06-16 Β· 4 obs
β 2018-06-16 00:33:22
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βNSns4.dnsdun.net2018-06-16 β 2018-06-16 Β· 4 obs
β 2018-06-16 00:33:22
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βNSns4.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βNSns5.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βNSns6.ezdnscenter.com2015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βA104.195.4.32026-03-10 β 2026-03-25 Β· 2 obs
β 2026-03-25 06:02:04
βA123.1.183.1172015-08-13 β 2016-06-26 Β· 4 obs
β 2016-06-26 05:38:56
β 2018-06-16 00:33:22
β 2026-03-25 06:02:04
βA15.197.240.202026-03-10 β 2026-03-25 Β· 3 obs
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
βA23.80.247.1482018-06-16 β 2018-06-16 Β· 4 obs
β 2018-06-16 00:33:22
β 2026-03-10 09:02:30
β 2026-03-25 06:02:04
π DNS Trace
π Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| com | d.gtld-servers.net, m.gtld-servers.net, f.gtld-servers.net, g.gtld-servers.net... | - |
| mideacrac.com | dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com | 2 records |
β Authoritative Response
Server:162.251.82.2
NS records: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com
π DNSSEC Status
β οΈ Insecure (no DNSSEC)
No DS record for mideacrac.com (unsigned zone)
β±οΈ Timing
Total: 255ms | Queries: -
π Records
| Type | Count | Sample Data |
|---|---|---|
| A | 1 | 15.197.240.20 |
| SOA | 1 | ns1.verification-hold.suspended-domain.c |
π Glue Records Collected
Total: 2
Out-of-bailiwick: 2 (dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com)
Analysis
IP Addresses
mideacrac.com points to IP number: 15.197.240.20.
Other host names such as www.lifeseasoned.com, hu.www.mediarab.com, biznessclinic.life, extension-browser-nkbihsdfnklwefkwemkwfkmkmslqldqrgr.info.vancltyappllance.com and great(0x6675636b).info share IPs with mideacrac.com.
Name Servers
mideacrac.com is delegated to three name servers: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com and ns1.verification-hold.suspended-domain.com.
mideacrac.com at least partially shares name servers with other domains, for instance mailserver47-coinbase.com, arindam.tech, coinbase-100550.com, fireplacemantel.info and alpamediamx.com.
these name servers are commonly used together with the name servers dns12.parkpage.foundationapi.com, ns2.verification-hold.suspended-domain.com, dns9.parkpage.foundationapi.com, dns7.parkpage.foundationapi.com and dns8.parkpage.foundationapi.com.
Host names with a single IP:
dns10.parkpage.foundationapi.com points to: 162.251.82.2.
dns11.parkpage.foundationapi.com points to: 162.251.82.254.
ns1.verification-hold.suspended-domain.com points to: 127.0.0.1.