apg-bd.com - robtex.com
apg-bd.com
| DNSSEC | β οΈ Not signed | ||||||
| A | 15.197.240.20πΊπΈ Amazon15.197.240.0/20 | ||||||
| PTR | acf3b736b777428f5.awsglobalaccelerator.com | ||||||
| NS | ns1.verification-hold.suspended-domain.com β | ||||||
| A | 127.0.0.1 | ||||||
| NS | dns10.parkpage.foundationapi.com β οΈ Not in zone NS records | ||||||
| A | 162.251.82.2πΊπΈ Cloudflare162.251.82.0/24 PDR | ||||||
| NS | dns11.parkpage.foundationapi.com β οΈ Not in zone NS records | ||||||
| A | 162.251.82.254πΊπΈ Cloudflare162.251.82.0/24 PDR | ||||||
| SOA | ns1.verification-hold.suspended-domain.comadmin@suspended-domain.com 2012-02-20 #12 | ||||||
com
| DNSSEC | π Signed (DS record present) | ||||||
| NS | a.gtld-servers.net β | ||||||
| NS | b.gtld-servers.net | ||||||
| NS | c.gtld-servers.net | ||||||
| NS | d.gtld-servers.net | ||||||
| NS | e.gtld-servers.net | ||||||
| NS | f.gtld-servers.net | ||||||
| NS | g.gtld-servers.net | ||||||
| NS | h.gtld-servers.net | ||||||
| NS | i.gtld-servers.net | ||||||
| NS | j.gtld-servers.net | ||||||
| NS | k.gtld-servers.net | ||||||
| NS | l.gtld-servers.net | ||||||
| NS | m.gtld-servers.net | ||||||
| SOA | a.gtld-servers.netnstld@verisign-grs.com serial=1776974116 | ||||||
Previously MX for
apg-bd.com |
Same first word
apg-bd.com |
Similar names
DNS History
8 records (4 active, 4 former)
βNSdns10.parkpage.foundationapi.com2026-03-26 β 2026-04-23 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βNSdns11.parkpage.foundationapi.com2026-03-26 β 2026-04-23 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βNSns1.verification-hold.suspended-domain.com2026-03-26 β 2026-04-23 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βNSns3.zhostbd.com2017-05-08 β 2017-05-08 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βNSns4.zhostbd.com2017-05-08 β 2017-05-08 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βMXapg-bd.com2017-05-08 β 2017-05-08 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βA15.197.240.202026-03-26 β 2026-04-23 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
βA67.225.139.1962017-05-08 β 2017-05-08 Β· 3 obs
β 2026-03-26 09:43:20
β 2026-04-23 20:03:32
π DNS Trace
π Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| com | a.gtld-servers.net, b.gtld-servers.net, c.gtld-servers.net, d.gtld-servers.net... | - |
| apg-bd.com | dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com | 2 records |
β Authoritative Response
Server:162.251.82.254
NS records: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com
π DNSSEC Status
β οΈ Insecure (no DNSSEC)
No DS record for apg-bd.com (unsigned zone)
β±οΈ Timing
Total: 431ms | Queries: -
π Records
| Type | Count | Sample Data |
|---|---|---|
| A | 1 | 15.197.240.20 |
| SOA | 1 | ns1.verification-hold.suspended-domain.c |
π Glue Records Collected
Total: 2
Out-of-bailiwick: 2 (dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com)
Analysis
IP Addresses
apg-bd.com points to a single IP number: 15.197.240.20.
Other host names, for instance mail.eltimbre.com, ns3.u-rent-it.com.ardeleted.com, birdmichael.com, mail.kitatera.com and evmufoabbo.000space.com share IP numbers with apg-bd.com.
Name Servers
The delegation for apg-bd.com is handled by three name servers: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com and ns1.verification-hold.suspended-domain.com.
apg-bd.com at least partially shares name servers with other domains, for instance biznessclinic.life, extension-browser-nkbihsdfnklwefkwemkwfkmkmslqldqrgr.info.vancltyappllance.com, digisol.biz, great(0x6675636b).info and proisotrepl.com.
These name servers are commonly used alongside ns2.verification-hold.suspended-domain.com, dns13.parkpage.foundationapi.com, dns14.parkpage.foundationapi.com and dns9.parkpage.foundationapi.com.
Host names with one IP number:
dns10.parkpage.foundationapi.com points to 162.251.82.2.
dns11.parkpage.foundationapi.com points to 162.251.82.254.
ns1.verification-hold.suspended-domain.com points to 127.0.0.1.