m2mconnectivity.com.au - robtex.com
m2mconnectivity.com.au
| DNSSEC | β οΈ Not signed | ||||||
| A | 141.193.213.10πΊπΈ CLOUDFLARESPECTRUM141.193.213.0/24 WPEngine, Inc. 504 Lavaca Street, 1000, Austin, TX 78701, US | ||||||
| A | 141.193.213.11πΊπΈ CLOUDFLARESPECTRUM141.193.213.0/24 WPEngine, Inc. 504 Lavaca Street, 1000, Austin, TX 78701, US | ||||||
| NS | ns0.dnsmadeeasy.com β | ||||||
| A | 2600:1800::1πΊπΈ Tiggee2600:1800::/48 DNS Made Easy anycast network | ||||||
| PTR | ns0.dnsmadeeasy.com | ||||||
| A | 208.94.148.2πΊπΈ Tiggee208.94.148.0/24 DNS Made Easy anycast network | ||||||
| PTR | ns0.dnsmadeeasy.com | ||||||
| NS | ns1.dnsmadeeasy.com | ||||||
| A | 2600:1801:1::1πΊπΈ Tiggee2600:1801:1::/48 DNS Made Easy anycast network | ||||||
| PTR | ns1.dnsmadeeasy.com | ||||||
| A | 208.80.124.2πΊπΈ Tiggee208.80.124.0/24 DNS Made Easy anycast network | ||||||
| PTR | ns1.dnsmadeeasy.com | ||||||
| NS | ns2.dnsmadeeasy.com | ||||||
| A | 2600:1802:2::1πΊπΈ Tiggee2600:1802:2::/48 DNS Made Easy anycast network | ||||||
| PTR | ns2.dnsmadeeasy.com | ||||||
| A | 208.80.126.2πΊπΈ Tiggee208.80.126.0/24 DNS Made Easy anycast network | ||||||
| PTR | ns2.dnsmadeeasy.com | ||||||
| NS | ns3.dnsmadeeasy.com | ||||||
| A | 2600:1801:3::1πΊπΈ Tiggee2600:1801:3::/48 DNS Made Easy anycast network | ||||||
| PTR | ns3.dnsmadeeasy.com | ||||||
| A | 208.80.125.2πΊπΈ Tiggee208.80.125.0/24 DNS Made Easy anycast network | ||||||
| PTR | ns3.dnsmadeeasy.com | ||||||
| NS | ns4.dnsmadeeasy.com | ||||||
| A | 2600:1802:4::1πΊπΈ Tiggee2600:1802:4::/48 DNS Made Easy anycast network | ||||||
| PTR | ns4.dnsmadeeasy.com | ||||||
| A | 208.80.127.2πΊπΈ Tiggee208.80.127.0/24 DNS Made Easy anycast network | ||||||
| PTR | ns4.dnsmadeeasy.com | ||||||
| MX | usb-smtp-inbound-1.mimecast.com β | ||||||
| A | 170.10.150.242πΊπΈ Mimecast-NA170.10.150.0/24 Mimecast NA | ||||||
| PTR | usb-smtp-delivery-2.mimecast.com | ||||||
| A | 170.10.152.242πΊπΈ Mimecast-NA170.10.152.0/24 Mimecast NA | ||||||
| PTR | usb-smtp-delivery-2.mimecast.com | ||||||
| MX | usb-smtp-inbound-2.mimecast.com β | ||||||
| A | 170.10.150.242πΊπΈ Mimecast-NA170.10.150.0/24 Mimecast NA | ||||||
| PTR | usb-smtp-delivery-2.mimecast.com | ||||||
| A | 170.10.152.242πΊπΈ Mimecast-NA170.10.152.0/24 Mimecast NA | ||||||
| PTR | usb-smtp-delivery-2.mimecast.com | ||||||
| TXT | google-site-verification=RtQiWkOtbAO1493TkXdor_0c6v0wDlFhFiB0qkCln4M | ||||||
| TXT | 0ed1fe018a98187b2d676a4b3d859e1682d212604a | ||||||
| TXT | zoho-verification=zb55217807.zmverify.zoho.com | ||||||
| TXT | knowbe4-site-verification=14738a7e33aa2c11b1ebe882c05efd7e | ||||||
| TXT | S0E0M52414 | ||||||
| TXT | anthropic-domain-verification-hp72hj=vTrjmttxljS6HDTlt3lSAHD7a | ||||||
| TXT | MS=ms95010454 | ||||||
| TXT | google-site-verification=vw4P8qK4EgbcDbvwU8f2tFXTArnKptXVqa0_gtRJfWI | ||||||
| TXT | v=spf1 include:usb._netblocks.mimecast.com include:spf.protection.outlook.com... | ||||||
| TXT | MS=ms86184442 | ||||||
| TXT | cursor-domain-verification-7can2z=vrDCyq7Bcqktckvd9leGWLLmb | ||||||
| SOA | ns0.dnsmadeeasy.comdns@dnsmadeeasy.com 2004-01-02 #44 | ||||||
com.au
| DNSSEC | β οΈ Not signed | ||||||
| NS | q.au β β οΈ Not in parent delegation | ||||||
| NS | a.au β οΈ Not in parent delegation | ||||||
| NS | r.au β οΈ Not in parent delegation | ||||||
| NS | s.au β οΈ Not in parent delegation | ||||||
| NS | t.au β οΈ Not in parent delegation | ||||||
| SOA | q.auhostmaster@donuts.email serial=1778353665 | ||||||
WOT: SAFE (34/100)
Subdomains
www.m2mconnectivity.com.au |
Same first word
m2mconnectivity.com.au |
DNS History
13 records (9 active, 4 former)
βNSns0.dnsmadeeasy.com2015-06-01 β 2026-05-09 Β· 2 obs
β 2026-05-09 19:20:14
βNSns1.dnsmadeeasy.com2015-06-01 β 2026-05-09 Β· 2 obs
β 2026-05-09 19:20:14
βNSns2.dnsmadeeasy.com2015-06-01 β 2026-05-09 Β· 2 obs
β 2026-05-09 19:20:14
βNSns3.dnsmadeeasy.com2015-06-01 β 2026-05-09 Β· 2 obs
β 2026-05-09 19:20:14
βNSns4.dnsmadeeasy.com2015-06-01 β 2026-05-09 Β· 2 obs
β 2026-05-09 19:20:14
βMXm2mconnectivity-com-au.mail.protection.outlook.com2015-06-01 β 2016-07-02 Β· 4 obs
β 2016-07-02 18:33:04
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βMXmx1.emailsrvr.com2015-06-01 β 2016-07-02 Β· 4 obs
β 2016-07-02 18:33:04
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βMXmx2.emailsrvr.com2015-06-01 β 2016-07-02 Β· 4 obs
β 2016-07-02 18:33:04
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βMXusb-smtp-inbound-1.mimecast.com2026-02-26 β 2026-05-09 Β· 3 obs
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βMXusb-smtp-inbound-2.mimecast.com2026-02-26 β 2026-05-09 Β· 3 obs
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βA141.193.213.102026-02-26 β 2026-05-09 Β· 3 obs
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βA141.193.213.112026-02-26 β 2026-05-09 Β· 3 obs
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
βA54.253.116.1062015-06-01 β 2016-07-02 Β· 4 obs
β 2016-07-02 18:33:04
β 2026-02-26 01:11:20
β 2026-05-09 19:20:14
π DNS Trace
π Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| au | s.au, r.au, q.au, t.au... | - |
| m2mconnectivity.com.au | ns0.dnsmadeeasy.com, ns1.dnsmadeeasy.com, ns2.dnsmadeeasy.com, ns3.dnsmadeeasy.com... | - |
β Authoritative Response
Server:208.80.126.2
NS records: ns0.dnsmadeeasy.com, ns1.dnsmadeeasy.com, ns2.dnsmadeeasy.com, ns3.dnsmadeeasy.com, ns4.dnsmadeeasy.com
π DNSSEC Status
β οΈ Insecure (no DNSSEC)
No DS record for m2mconnectivity.com.au (unsigned zone)
β±οΈ Timing
Total: 623ms | Queries: -
π Records
| Type | Count | Sample Data |
|---|---|---|
| A | 2 | 141.193.213.10, 141.193.213.11 |
| NS | 5 | ns0.dnsmadeeasy.com, ns4.dnsmadeeasy.com... |
| MX | 2 | usb-smtp-inbound-1.mimecast.com (pri: 10, usb-smtp-inbound-2.mimecast.com (pri: 10 |
| TXT | 11 | google-site-verification=vw4P8qK4EgbcDbv, cursor-domain-verification-7can2z=vrDCyq... |
| SOA | 1 | ns0.dnsmadeeasy.com dns.dnsmadeeasy.com |
Analysis
Hierarchy
m2mconnectivity.com.au is the parent of www.m2mconnectivity.com.au.
IP Addresses
m2mconnectivity.com.au resolves to two IP numbers: 141.193.213.10 and 141.193.213.11.
other host names including codecleanup.com, gsnn.us, athletetrainingandhealth.com, e3-series.com and christmassongs.org share IP numbers with m2mconnectivity.com.au.
Name Servers
m2mconnectivity.com.au is delegated to five name servers: ns0.dnsmadeeasy.com, ns1.dnsmadeeasy.com, ns2.dnsmadeeasy.com, ns3.dnsmadeeasy.com and ns4.dnsmadeeasy.com.
m2mconnectivity.com.au at least partially shares name servers with other domains, for instance immanuelbible.net, combsenterprises.com, twee.com, psumontco.com and rusve.com.
These name servers are commonly used alongside ns10.digicertdns.com, ns1.sportnginserver.com, ns2.sportnginserver.com, ns3.sportnginserver.com, ns4.sportnginserver.com and ns5.sportnginserver.com.
Host names with two IP numbers:
ns0.dnsmadeeasy.com points to 2600:1800::1 and 208.94.148.2
ns1.dnsmadeeasy.com points to 2600:1801:1::1 and 208.80.124.2
ns2.dnsmadeeasy.com points to 2600:1802:2::1 and 208.80.126.2
ns3.dnsmadeeasy.com points to 2600:1801:3::1 and 208.80.125.2
ns4.dnsmadeeasy.com points to 2600:1802:4::1 and 208.80.127.2
Mail Servers
Two mail servers handle m2mconnectivity.com.au: usb-smtp-inbound-1.mimecast.com and usb-smtp-inbound-2.mimecast.com.
m2mconnectivity.com.au shares the same mail server setup as other domains, for instance jimtidwellford.com, pace-at-home.org, seaboard.bm, westvirginiafamilyhealthplan.com and epochsl.com.
m2mconnectivity.com.au shares at least partially some mail servers with other domains, including miaandmaxx.com, gapsi.com and grantbulldogs.org.
Host names with two IP numbers:
usb-smtp-inbound-1.mimecast.com points to 170.10.150.242 and 170.10.152.242
usb-smtp-inbound-2.mimecast.com points to 170.10.150.242 and 170.10.152.242
Host names pointing to 170.10.150.242: usb-smtp-inbound-1.mimecast.com and usb-smtp-inbound-2.mimecast.com
Host names pointing to 170.10.152.242: usb-smtp-inbound-1.mimecast.com and usb-smtp-inbound-2.mimecast.com