24itech.com - robtex.com
24itech.com
| DNSSEC | ⚠️ Not signed | ||||||
| A | 15.197.240.20🇺🇸 Amazon15.197.240.0/20 | ||||||
| PTR | acf3b736b777428f5.awsglobalaccelerator.com | ||||||
| NS | ns1.verification-hold.suspended-domain.com ⭐ | ||||||
| A | 127.0.0.1 | ||||||
| PTR | localhost | ||||||
| PTR | ip-127-0-0-1.defastlink.net | ||||||
| NS | dns10.parkpage.foundationapi.com ⚠️ Not in zone NS records | ||||||
| A | 162.251.82.2🇺🇸 Cloudflare162.251.82.0/24 PDR Solutions LLC Route Object | ||||||
| NS | dns11.parkpage.foundationapi.com ⚠️ Not in zone NS records | ||||||
| A | 162.251.82.254🇺🇸 Cloudflare162.251.82.0/24 PDR Solutions LLC Route Object | ||||||
| SOA | ns1.verification-hold.suspended-domain.comadmin@suspended-domain.com 2012-02-20 #12 | ||||||
com
| DNSSEC | 🔒 Signed (DS record present) | ||||||
| NS | a.gtld-servers.net ⭐ | ||||||
| NS | b.gtld-servers.net | ||||||
| NS | c.gtld-servers.net | ||||||
| NS | d.gtld-servers.net | ||||||
| NS | e.gtld-servers.net | ||||||
| NS | f.gtld-servers.net | ||||||
| NS | g.gtld-servers.net | ||||||
| NS | h.gtld-servers.net | ||||||
| NS | i.gtld-servers.net | ||||||
| NS | j.gtld-servers.net | ||||||
| NS | k.gtld-servers.net | ||||||
| NS | l.gtld-servers.net | ||||||
| NS | m.gtld-servers.net | ||||||
| SOA | a.gtld-servers.netnstld@verisign-grs.com serial=1771291435 | ||||||
Same first word
24itech.com |
Similar names
DNS History
9 records (4 active, 5 former)
●NSdns10.parkpage.foundationapi.com2026-02-28 → 2026-02-28 · 2 obs
● 2026-02-28 02:05:56
●NSdns11.parkpage.foundationapi.com2026-02-28 → 2026-02-28 · 2 obs
● 2026-02-28 02:05:56
●NSns1.verification-hold.suspended-domain.com2026-02-28 → 2026-02-28 · 2 obs
● 2026-02-28 02:05:56
○NSns61.domaincontrol.com2015-10-16 → 2016-03-31 · 4 obs
● 2016-03-31 04:29:58
○ 2016-09-20 20:54:48
○ 2026-02-28 02:05:56
○NSns62.domaincontrol.com2015-10-16 → 2016-03-31 · 4 obs
● 2016-03-31 04:29:58
○ 2016-09-20 20:54:48
○ 2026-02-28 02:05:56
○MXmailstore1.secureserver.net2015-10-16 → 2016-03-31 · 4 obs
● 2016-03-31 04:29:58
○ 2016-09-20 20:54:48
○ 2026-02-28 02:05:56
○MXsmtp.secureserver.net2015-10-16 → 2016-03-31 · 4 obs
● 2016-03-31 04:29:58
○ 2016-09-20 20:54:48
○ 2026-02-28 02:05:56
●A15.197.240.202026-02-28 → 2026-02-28 · 2 obs
● 2026-02-28 02:05:56
○A50.62.242.932015-10-16 → 2016-03-31 · 4 obs
● 2016-03-31 04:29:58
○ 2016-09-20 20:54:48
○ 2026-02-28 02:05:56
🔍 DNS Trace
📋 Delegation Chain
| Zone | Nameservers | Glue |
|---|---|---|
| com | k.gtld-servers.net, i.gtld-servers.net, d.gtld-servers.net, a.gtld-servers.net... | - |
| 24itech.com | dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com | 2 records |
✅ Authoritative Response
Server: 162.251.82.254
NS records: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com
🔒 DNSSEC Status
⚠️ Insecure (no DNSSEC)
No DS record for 24itech.com (unsigned zone)
⏱️ Timing
Total: 325ms | Queries: -
📄 Records
| Type | Count | Sample Data |
|---|---|---|
| A | 1 | 15.197.240.20 |
| SOA | 1 | ns1.verification-hold.suspended-domain.c |
📌 Glue Records Collected
Total: 2
Out-of-bailiwick: 2 (dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com)
AI analysis
24itech.com points to a single IP number: 15.197.240.20.
other host names for instance ns1.bingoohost.com, mta12.bestofemail.com, mail.numed.in, www.jeogarcia.com and ayursoukhya.com share IP numbers with 24itech.com.
24itech.com is delegated to three name servers: dns10.parkpage.foundationapi.com, dns11.parkpage.foundationapi.com and ns1.verification-hold.suspended-domain.com.
24itech.com at least partially shares name servers with other domains, for instance mail.(0x736578)camsnow.net, realconstructora.com, www.lifeseasoned.com, biznessclinic.life and extension-browser-nkbihsdfnklwefkwemkwfkmkmslqldqrgr.info.vancltyappllance.com.
These name servers are commonly used with dns9.parkpage.foundationapi.com, ns2.verification-hold.suspended-domain.com, dns12.parkpage.foundationapi.com, dns15.parkpage.foundationapi.com, dns16.parkpage.foundationapi.com, dns19.parkpage.foundationapi.com and dns20.parkpage.foundationapi.com.
Host names with one IP number:
dns10.parkpage.foundationapi.com points to 162.251.82.2.
dns11.parkpage.foundationapi.com points to 162.251.82.254.
ns1.verification-hold.suspended-domain.com points to 127.0.0.1.